PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021646P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 364aa    MW: 39352.2 Da    PI: 8.4304
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021646P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1214.2e-3881141262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +e+ lkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGa+rnvPvGgg+r++ k+s
  MELO3C021646P1  81 PEAGLKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGAMRNVPVGGGCRRSSKRS 141
                     67889***************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3169130IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3184139IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.01285139IPR003851Zinc finger, Dof-type
PROSITE patternPS01361087123IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MVFSSVPVFL DPPNWPSQQP NQLQVSGCET NNAQHLPPPA PSANGGSGGG SGGGGGGGGG  60
PGSIRPGSMT DRARLAKIPQ PEAGLKCPRC ESTNTKFCYF NNYSLTQPRH FCKTCRRYWT  120
RGGAMRNVPV GGGCRRSSKR SSKGGSNNRS KSPGGSSTST STVSSNSCTT DIISQQLAHH  180
HHPPPTTHLP FFSQNLHHLS EFGNLGLNFE ALHIPNSLPS SAESSSVLSS GIISDHHQWK  240
IPLFGNLHQQ NGIYSNFMAD QDHHHQQQTA DFTNYQRLSK PLLENGFNHQ LENININNNN  300
NSMKILEDTQ GVNNLSRNFL GIHPNEDQFW NSTTTTTTAG NIGWSSDQIS DHFNSTSSTT  360
HLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134140RRSSKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818900.0LN681890.1 Cucumis melo genomic scaffold, anchoredscaffold00048.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008458891.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLA0A0A0KNR80.0A0A0A0KNR8_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-36DNA binding with one finger 2.4